Shop

Showing 17–32 of 79 results

  • CJC 1295 No DAC 5.17mg Lot 25341

    CJC 1295 No DAC 5.17mg Lot 25341

    See Current COA
    $17.00

    CJC-1295 (No DAC) CAS Number: 863288-34-0Molecular Formula: C152H252N44O42Molecular Weight: 3,364 g/molStructural Sequence: Modified GRF(1-29)PubChem CID: 9831698ChemSpider ID: 8007430

  • Epithalon 10.06mg Lot 25245

    Epithalon 10.06mg Lot 25245

    See Current COA
    $22.00

    Epithalon CAS Number: 307297-39-8Molecular Formula: C14H22N4O9Molecular Weight: 390.35 g/molStructural Sequence: Ala-Glu-Asp-GlyPubChem CID: 219024ChemSpider ID: 189660

  • GHK-Cu 57.17mg Lot 26182

    GHK-Cu 57.17mg Lot 26182

    See Current COA
    $18.00

    GHK-Cu (Copper Tripeptide-1) CAS Number: 89030-95-5Molecular Formula: C₁₄H₂₄N₆O₄CuMolecular Weight: 401.93 g/molStructural Sequence: Gly-His-Lys : Cu²⁺PubChem CID: 918257ChemSpider ID: 797047

  • GHK-cu Cosmetic Grade Raw Powder, 2grams, Lot 26157

    GHK-cu Cosmetic Grade Raw Powder, 2grams, Lot 26157

    See Current COA
    $39.99

    2 grams raw Cosmetic Grade GHK-cu Powder. Slight overfill.

  • Glow 70 GHK 61.96mg/TB 13.32mg/BPC 12.51mg Lot 26149

    Glow 70 GHK 61.96mg/TB 13.32mg/BPC 12.51mg Lot 26149

    See Current COA
    $69.00

    Glow (GHK-Cu / BPC-157 / TB-500) CAS: Multiple — component specificFormula: BlendMolecular Weight: Blend dependentSequence: GHK-Cu BPC-157 TB-500 fragment

  • Hydra Stamp, Sterile, 20 needle, .5mm

    Hydra Stamp, Sterile, 20 needle, .5mm

    $9.99

    The Hydra Stamp is a professional-grade beauty tool designed to help deliver your favorite skincare serums directly to the surface layers of the skin for enhanced absorption. Its ultra-fine titanium tips create micro-channels that work with your skincare routine to support a smooth, refreshed, and hydrated appearance. This easy-to-use device is perfect for incorporating into…

  • IGF1-Lr3 1.08 mg Lot 26031

    IGF1-Lr3 1.08 mg Lot 26031

    See Current COA
    $39.00

    IGF-1 LR3 — Technical Specifications CAS Number:946870-92-4 Molecular Formula:C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₇ Molecular Weight:≈ 9,112.6 g/mol Structural Sequence (Amino Acid Sequence):MFPAMPLLSLFVNASSHQGIVDECCFRSCDLRRLEMYCAPLKPAKSAAGIVQQTPTKTSVEEEKYGPLKPKSA(Synthetic human IGF-1 analog with N-terminal Arg extension and Arg³ substitution) PubChem CID:Not formally assigned (peptide biologic entry varies by salt/registry) ChemSpider ID:Not formally assigned (large recombinant peptide; database entries limited)

  • Ipamorelin 5.91mg Lot 25340

    Ipamorelin 5.91mg Lot 25340

    See Current COA
    $18.00

    Ipamorelin CAS Number: 170851-70-4Molecular Formula: C₃₈H₄₉N₉O₅Molecular Weight: 711.86 g/molStructural Sequence: Aib-His-D-2-Nal-D-Phe-Lys-NH₂PubChem CID: 9831659ChemSpider ID: 8007390

  • KLOW Blend Lot 26008 GHK 73.7, BPC 12.6, TB500 11.7, KPV 11.7

    KLOW Blend Lot 26008 GHK 73.7, BPC 12.6, TB500 11.7, KPV 11.7

    See Current COA
    $99.00

    KLOW (KPV / BPC-157 / GHK-Cu / TB-500) CAS: Multiple — component specificFormula: BlendMolecular Weight: Blend dependentSequence: KPV BPC-157 GHK-Cu TB-500 fragment

  • KPV 10mg Lot 25139 11.45mg

    KPV 10mg Lot 25139 11.45mg

    See Current COA
    $35.00

    KPV CAS Number: 67727-97-3Molecular Formula: C16H26N4O4Molecular Weight: 338.4 g/molStructural Sequence: Lys-Pro-ValPubChem CID: 16129661ChemSpider ID: 4470504

  • L-Glutathione 627.3mg Lot 25342

    L-Glutathione 627.3mg Lot 25342

    See Current COA
    $19.00

    L-Glutathione CAS Number: 70-18-8Molecular Formula: C10H17N3O6SMolecular Weight: 307.32 g/molStructural Sequence: γ-Glu-Cys-GlyPubChem CID: 124886ChemSpider ID: 110791

  • Liftheng Peptide Ice Face Mask, Box 20

    Liftheng Peptide Ice Face Mask, Box 20

    $10.99

    Overnight skin lotion reported to have great effects. Translated from the packaging: Skin-friendly, moisturizing and non-sticky, it contains blue copper peptide; ingredients imported from Korea: CENTELLA ASIATICA leaf extract, oligopeptide-1, ALOE BARBADENSIS leaf extract; ingredients imported from the UK: Sodium hyaluronate; its refreshing and cool texture refreshes the skin, moisturizes and cares for tender and beautiful skin. When you wake up the next day, your skin will appear supple, plump, smooth and elastic, with a youthful radiance.

    Skin care enthusiasts on popular forums report anti-aging benefits and a reduction of fine lines, discoloration, and an overall youthful glow.

    The manufacturer claims there is blue copper peptide in the formula, but the box does not have any reference to GHK-Cu.

    INGREDIENTS:

    Water, glycerin, dimethicone, phenoxyethanol, carbomer, triethanolamine, methylparaben, polyacrylamide, allantoin.
    Other trace ingredients: titanium dioxide, glyceryl glucoside, C13-14 iso-paraffin, xanthan gum, laureth-7, disodium EDTA, fragrance, copper tripeptide-1, sodium hyaluronate, beta-glucan , Nicotinamide, Centella Asiatica (CENTELLA ASIATICA) leaf extract, Oligopeptide-1, Aloe Barbadensis (ALOE BARBADENSIS) leaf extract
    INSTRUCTIONS:
    Before going to bed, after cleansing, take an appropriate amount of product and apply it evenly on your face (avoiding the skin around the eyes and lips). You can leave it on overnight and wash it off with water the next morning.
    Please keep it in a cool place away from high temperatures and direct sunlight; keep it out of the reach of children.
  • Melanotan I 9.25mg Lot 26160

    Melanotan I 9.25mg Lot 26160

    See Current COA
    $28.00

    Melanotan I CAS Number: 75921-69-6Molecular Formula: C78H111N21O19Molecular Weight: 1,646.9 g/molStructural Sequence: Ac-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-NH₂PubChem CID: 16130198ChemSpider ID: 4470581

  • Melanotan II 11.46mg Lot 26069

    Melanotan II 11.46mg Lot 26069

    See Current COA
    $15.00

    Melanotan II CAS Number: 121062-08-6Molecular Formula: C₅₀H₆₉N₁₅O₉Molecular Weight: 1,024.2 g/molStructural Sequence: Ac-Nle-Asp-His-D-Phe-Arg-Trp-Lys-NH₂PubChem CID: 16130199ChemSpider ID: 4470582

  • MOTS-C 14.72mg Lot 26150

    MOTS-C 14.72mg Lot 26150

    See Current COA
    $45.00

    MOTS-c CAS Number: 1627965-70-9Molecular Formula: C₁₀₁H₁₆₄N₂₈O₂₂Molecular Weight: 2,174.4 g/molStructural Sequence: Met-Arg-Trp-Gln-Glu-Met-Gly-Gly-Arg-Ala-Arg-Gly-Ser-Phe-Arg-ProPubChem CID: 145994159ChemSpider ID: 81361822

  • NAD+ 1121.55mg Lot 26134

    NAD+ 1121.55mg Lot 26134

    See Current COA
    $89.00

    NAD+ CAS Number: 53-84-9Molecular Formula: C21H27N7O14P2Molecular Weight: 663.4 g/molStructural Sequence: Dinucleotide coenzymePubChem CID: 5893ChemSpider ID: 5686

Age Verification Required

All products on this site are for research and development use only. Products are not for human consumption of any kind. The statements made on this website have not been evaluated by the US Food and Drug Administration. The statements and the products of this company are not intended to diagnose, treat, cure, or prevent any disease. BioPep Research Peptides is not a compounding pharmacy or chemical compounding facility as defined under 503A of the Federal Food, Drug, and Cosmetic Act. BioPep Research Peptides is not an outsourcing facility as defined under 503B of the Federal Food, Drug, and Cosmetic Act. All products are sold for research, laboratory, or analytical purposes only, and are not for human consumption.

I confirm I am 21+ years of age or older.
Month
Day
Year